Lineage for d7ezia1 (7ezi A:1-316)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2438355Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2438356Protein automated matches [190793] (30 species)
    not a true protein
  7. 2438461Species Oryza sativa [TaxId:39947] [405251] (2 PDB entries)
  8. 2438462Domain d7ezia1: 7ezi A:1-316 [405283]
    Other proteins in same PDB: d7ezia2
    automated match to d3eaua_
    complexed with mg

Details for d7ezia1

PDB Entry: 7ezi (more details), 1.2 Å

PDB Description: rice l-galactose dehydrogenase (apo form)
PDB Compounds: (A:) L-galactose dehydrogenase

SCOPe Domain Sequences for d7ezia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ezia1 c.1.7.0 (A:1-316) automated matches {Oryza sativa [TaxId: 39947]}
melrelgatglrvspvgfgasplghvfgdvprdvaraavrraldlginffdtspyyggtv
sesvlgdclraagvprdrfvvatkcgryregfdfsaarvtrsvdeslarlgldyvdilhc
hdieftdldqivnetipvlqkikesgkarfigitglplsiytyvldqvppgsvdvilsyc
hygindtalvdllpylkskgvgvisasplamglltdngppewhpapkelklacraaadhc
kkkgknitklamqyslmnneistvlvgmnspeqveenvaaaielstsgidkellheveai
lepvknmtwssgieqa

SCOPe Domain Coordinates for d7ezia1:

Click to download the PDB-style file with coordinates for d7ezia1.
(The format of our PDB-style files is described here.)

Timeline for d7ezia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7ezia2