Lineage for d2cbla3 (2cbl A:264-351)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135973Fold d.93: SH2-like [55549] (1 superfamily)
  4. 135974Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 135975Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 136008Protein Cbl [55587] (1 species)
  7. 136009Species Human (Homo sapiens) [TaxId:9606] [55588] (3 PDB entries)
  8. 136010Domain d2cbla3: 2cbl A:264-351 [40528]
    Other proteins in same PDB: d2cbla1, d2cbla2

Details for d2cbla3

PDB Entry: 2cbl (more details), 2.1 Å

PDB Description: n-terminal domain of cbl in complex with its binding site on zap-70

SCOP Domain Sequences for d2cbla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbla3 d.93.1.1 (A:264-351) Cbl {Human (Homo sapiens)}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltg

SCOP Domain Coordinates for d2cbla3:

Click to download the PDB-style file with coordinates for d2cbla3.
(The format of our PDB-style files is described here.)

Timeline for d2cbla3: