SCOPe 2.07: Domain d7eno1_: 7eno 1:

Lineage for d7eno1_ (7eno 1:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (25 species)
   not a true protein

7. Species Foot-and-mouth disease virus - type o [TaxId:12118] [335439] (3 PDB entries)

8. Domain d7eno1_: 7eno 1: [405266]
   automated match to d1fmd1_
   mutant

Details for d7eno1_

PDB Entry: 7eno, 3.15 Å

PDB Description: mutant strain m3 of foot-and-mouth disease virus type o

PDB Compounds: (1:) VP1 of O type FMDV capsid

SCOPe Domain Sequences for d7eno1_:

Sequence, based on SEQRES records:

>d7eno1_ b.121.4.1 (1:) automated matches {Foot-and-mouth disease virus - type o [TaxId: 12118]}
ttstgesadpvtttvenyggetqvqrrhhtdvsfildrfvkvtpkdsinvldlmqtpsht
lvgallrtatyyfadlevavkhkgdltwvpngapvaaldnttnptayhkapltrlalpyt
aphrvlatvyngeckyaegslpnvrgdlqvlaqkaarplptsfnygaikatrviellyrm
kraetycprpllavhpsaarhkqkivap

Sequence, based on observed residues (ATOM records):

>d7eno1_ b.121.4.1 (1:) automated matches {Foot-and-mouth disease virus - type o [TaxId: 12118]}
ttstgesadpvtttvenyggetqvqrrhhtdvsfildrfvkvtpkdsinvldlmqtpsht
lvgallrtatyyfadlevavkhkgdltwvpngapvaaldnttnptayhkapltrlalpyt
aphrvlatvyngrplptsfnygaikatrviellyrmkraetycprpllavhpsaarhkqk
ivap

Timeline for d7eno1_:

• d7eno1_ is new in SCOPe 2.07-stable
  
• d7eno1_ appears in the current release, SCOPe 2.08