SCOP 1.59: Domain d1bf5a3: 1bf5 A:569-710

Lineage for d1bf5a3 (1bf5 A:569-710)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (20 proteins)

6. Protein STAT-1 [55583] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55584] (1 PDB entry)

8. Domain d1bf5a3: 1bf5 A:569-710 [40526]
   Other proteins in same PDB: d1bf5a1, d1bf5a2

Details for d1bf5a3

PDB Entry: 1bf5, 2.9 Å

PDB Description: tyrosine phosphorylated stat-1/dna complex

SCOP Domain Sequences for d1bf5a3:

Sequence; same for both SEQRES and ATOM records:

>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens)}
llplwndgcimgfiskererallkdqqpgtfllrfsessregaitftwversqnggepdf
havepytkkelsavtfpdiirnykvmaaenipenplkylypnidkdhafgkyysrgyikt
elisvs

Timeline for d1bf5a3:

• d1bf5a3 first appeared (with stable ids) in SCOP 1.55
  
• d1bf5a3 appears in SCOP 1.57
  
• d1bf5a3 appears in SCOP 1.61
  
• d1bf5a3 appears in the current release, SCOPe 2.08