Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (20 proteins) |
Protein STAT-1 [55583] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55584] (1 PDB entry) |
Domain d1bf5a3: 1bf5 A:569-710 [40526] Other proteins in same PDB: d1bf5a1, d1bf5a2 |
PDB Entry: 1bf5 (more details), 2.9 Å
SCOP Domain Sequences for d1bf5a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens)} llplwndgcimgfiskererallkdqqpgtfllrfsessregaitftwversqnggepdf havepytkkelsavtfpdiirnykvmaaenipenplkylypnidkdhafgkyysrgyikt elisvs
Timeline for d1bf5a3: