Lineage for d1bf5a3 (1bf5 A:569-710)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34639Protein STAT-1 [55583] (1 species)
  7. 34640Species Human (Homo sapiens) [TaxId:9606] [55584] (1 PDB entry)
  8. 34641Domain d1bf5a3: 1bf5 A:569-710 [40526]
    Other proteins in same PDB: d1bf5a1, d1bf5a2

Details for d1bf5a3

PDB Entry: 1bf5 (more details), 2.9 Å

PDB Description: tyrosine phosphorylated stat-1/dna complex

SCOP Domain Sequences for d1bf5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens)}
llplwndgcimgfiskererallkdqqpgtfllrfsessregaitftwversqnggepdf
havepytkkelsavtfpdiirnykvmaaenipenplkylypnidkdhafgkyysrgyikt
elisvs

SCOP Domain Coordinates for d1bf5a3:

Click to download the PDB-style file with coordinates for d1bf5a3.
(The format of our PDB-style files is described here.)

Timeline for d1bf5a3: