Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (4 species) not a true protein |
Species Chlamydomonas reinhardtii [TaxId:3055] [370435] (5 PDB entries) |
Domain d7dz73_: 7dz7 3: [405255] Other proteins in same PDB: d7dz7a_, d7dz7b_, d7dz7c_, d7dz7d_, d7dz7e_, d7dz7f_, d7dz7j_, d7dz7u_, d7dz7w_, d7dz7x_, d7dz7y_, d7dz7z_ automated match to d5l8r2_ complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant |
PDB Entry: 7dz7 (more details), 2.84 Å
SCOPe Domain Sequences for d7dz73_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dz73_ f.43.1.0 (3:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} qlyvgasqsslayldgslpgdfgfdplglldpvnsggfiepkwlqyseviharwamlgaa gciapevlgaaglipdatnikwfesgvippagsyngywadpytiffveivamqfaelrrl qdfrypgsmgqqyflgleaifkgsgdaaypggpffnlfnlgkteaamkelklkeikngrl amlamlgygaqavmtgkgpfqnlvehladpvnnniltnfa
Timeline for d7dz73_: