SCOPe 2.08: Domain d7e7yb2: 7e7y B:110-212

Lineage for d7e7yb2 (7e7y B:110-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d7e7yb2: 7e7y B:110-212 [405250]
   Other proteins in same PDB: d7e7ya_, d7e7yb1, d7e7yc_, d7e7yd1, d7e7ye_, d7e7yr_
   automated match to d4yc2c2

Details for d7e7yb2

PDB Entry: 7e7y, 2.41 Å

PDB Description: crystal structure of the sars-cov-2 s rbd in complex with bd-623 fab

PDB Compounds: (B:) BD-623 Fab L

SCOPe Domain Sequences for d7e7yb2:

Sequence; same for both SEQRES and ATOM records:

>d7e7yb2 b.1.1.2 (B:110-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d7e7yb2:

• d7e7yb2 first appeared in SCOPe 2.07