Lineage for d7e8cj_ (7e8c J:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368959Domain d7e8cj_: 7e8c J: [405231]
    Other proteins in same PDB: d7e8ce_, d7e8cp_, d7e8cq_
    automated match to d1igml_

Details for d7e8cj_

PDB Entry: 7e8c (more details), 3.16 Å

PDB Description: sars-cov-2 s-6p in complex with 9 fabs
PDB Compounds: (J:) 368-2 l

SCOPe Domain Sequences for d7e8cj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e8cj_ b.1.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasiscrssqsllhsngylyldwylqkpgqspqlliylgsnra
sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpgtfgqgtrleik

SCOPe Domain Coordinates for d7e8cj_:

Click to download the PDB-style file with coordinates for d7e8cj_.
(The format of our PDB-style files is described here.)

Timeline for d7e8cj_: