SCOPe 2.07: Domain d7e8ic_: 7e8i C:

Lineage for d7e8ic_ (7e8i C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (12 PDB entries)

8. Domain d7e8ic_: 7e8i C: [405214]
   Other proteins in same PDB: d7e8ib_, d7e8id_, d7e8if_, d7e8ih_, d7e8il_
   automated match to d1eqza_
   protein/DNA complex

Details for d7e8ic_

PDB Entry: 7e8i, 3.1 Å

PDB Description: structural insight into brca1-bard1 complex recruitment to damaged chromatin

PDB Compounds: (C:) histone h2a

SCOPe Domain Sequences for d7e8ic_:

Sequence; same for both SEQRES and ATOM records:

>d7e8ic_ a.22.1.1 (C:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
trakactrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagna
ardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllp

Timeline for d7e8ic_:

• d7e8ic_ is new in SCOPe 2.07-stable
  
• d7e8ic_ appears in the current release, SCOPe 2.08