Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (8 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (12 PDB entries) |
Domain d7e8ic_: 7e8i C: [405214] Other proteins in same PDB: d7e8ib_, d7e8id_, d7e8if_, d7e8ih_, d7e8il_ automated match to d1eqza_ protein/DNA complex |
PDB Entry: 7e8i (more details), 3.1 Å
SCOPe Domain Sequences for d7e8ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e8ic_ a.22.1.1 (C:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} trakactrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagna ardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllp
Timeline for d7e8ic_: