Lineage for d7e2wa_ (7e2w A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513666Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2513667Protein automated matches [190603] (24 species)
    not a true protein
  7. 2513772Species Ostreococcus tauri [TaxId:70448] [378192] (5 PDB entries)
  8. 2513773Domain d7e2wa_: 7e2w A: [405202]
    automated match to d2qfwd_
    complexed with flc, gol, ict, ipa, mg

Details for d7e2wa_

PDB Entry: 7e2w (more details), 1.8 Å

PDB Description: crystal structure of isocitrate dehydrogenase from ostreococcus tauri in complex with isocitrate and magnesium(ii)
PDB Compounds: (A:) Isocitrate dehydrogenase (NAD(+)), mitochondrial

SCOPe Domain Sequences for d7e2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e2wa_ c.77.1.0 (A:) automated matches {Ostreococcus tauri [TaxId: 70448]}
kitaapmvyvrgeemtayvmdlirsrwieprvdvggwetfdlraknrddtedrvlrdvie
agkrikaifkeptvtptadqvkrlglrkswgspngamrrgwngitisrdtihidgvelgy
kkpvlferhavggeysagyknvgkgkltttftpsegpdagktvvvdereivdeeaavvty
hnpydnvhdlarfffgrcleakvtpyvvtkktvfkwqepfwqimrtvfdeefkaqfvaag
vmkegeelvhllsdaatmklvqwrqggfgmaahnydgdvltdelaqvhkspgfitsnlvg
vhedgtlikefeashgtvadmdearlrgeetslnplgmvegligamnhaadvhnidrdrt
hafttkmrtvihqlfregkgtrdlcgpsgltteqfidavaerl

SCOPe Domain Coordinates for d7e2wa_:

Click to download the PDB-style file with coordinates for d7e2wa_.
(The format of our PDB-style files is described here.)

Timeline for d7e2wa_: