Lineage for d1csza_ (1csz A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (20 proteins) 
Protein Syk tyrosine kinase [55575] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries) 
Domain d1csza_: 1csz A: [40520]
Details for d1csza_
PDB Entry: 1csz (more details)
PDB Description: syk tyrosine kinase c-terminal sh2 domain complexed with a phosphopeptidefrom the gamma chain of the high affinity immunoglobin g receptor, nmr
SCOP Domain Sequences for d1csza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1csza_ d.93.1.1 (A:) Syk tyrosine kinase {Human (Homo sapiens)}
gsrrasvgshekmpwfhgkisreeseqivligsktngkflirardnngsyalcllhegkv
lhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltvpcqkigtq
SCOP Domain Coordinates for d1csza_:
Click to download the PDB-style file with coordinates for d1csza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1csza_:
- d1csza_ first appeared (with stable ids) in SCOP 1.55
- d1csza_ appears in SCOP 1.59
- d1csza_ appears in the current release, SCOPe 2.08, called d1csza1
View in 3D