SCOPe 2.07: Domain d7e88b2: 7e88 B:107-212

Lineage for d7e88b2 (7e88 B:107-212)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d7e88b2: 7e88 B:107-212 [405198]
Other proteins in same PDB: d7e88b1, d7e88c_, d7e88e1, d7e88f_, d7e88h1, d7e88i_, d7e88k1, d7e88l_
automated match to d1dn0a2

Details for d7e88b2

PDB Entry: 7e88 (more details), 3.14 Å

PDB Description: crystal structure of the sars-cov-2 s rbd in complex with bd-515 fab

PDB Compounds: (B:) BD-515 Fab Light Chain

SCOPe Domain Sequences for d7e88b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e88b2 b.1.1.2 (B:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d7e88b2:

Click to download the PDB-style file with coordinates for d7e88b2.
(The format of our PDB-style files is described here.)

Timeline for d7e88b2: