SCOPe 2.07: Domain d7e88b1: 7e88 B:1-106

Lineage for d7e88b1 (7e88 B:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d7e88b1: 7e88 B:1-106 [405197]
   Other proteins in same PDB: d7e88b2, d7e88c_, d7e88e2, d7e88f_, d7e88h2, d7e88i_, d7e88k2, d7e88l_
   automated match to d1dn0a1

Details for d7e88b1

PDB Entry: 7e88, 3.14 Å

PDB Description: crystal structure of the sars-cov-2 s rbd in complex with bd-515 fab

PDB Compounds: (B:) BD-515 Fab Light Chain

SCOPe Domain Sequences for d7e88b1:

Sequence; same for both SEQRES and ATOM records:

>d7e88b1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdinkylnwyqqkpgkapkllifdashletgvps
rfsasgsgtdftftisslqpediatyychqydnlprtfgqgtrlei

Timeline for d7e88b1:

• d7e88b1 is new in SCOPe 2.07-stable
  
• d7e88b1 appears in the current release, SCOPe 2.08