Lineage for d7e0jy_ (7e0j Y:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633630Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2633631Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2633632Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)
  6. 2633645Protein automated matches [190507] (3 species)
    not a true protein
  7. 2633646Species Chlamydomonas reinhardtii [TaxId:3055] [377998] (5 PDB entries)
  8. 2633658Domain d7e0jy_: 7e0j Y: [405190]
    automated match to d2bhwa_
    complexed with chl, cla, lhg, lut, nex, tpo, xat; mutant

Details for d7e0jy_

PDB Entry: 7e0j (more details), 3.13 Å

PDB Description: lhcii-1 in the state transition supercomplex psi-lhci-lhcii from the double phosphatase mutant pph1;pbcp of chlamydomonas reinhardti.
PDB Compounds: (Y:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d7e0jy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e0jy_ f.43.1.1 (Y:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
giefygpnrakwlgpysenatpayltgefpgdygwdtaglsadpetfkryreleliharw
amlgalgcitpellaksgtqfgeavwfkagaqifseggldylgnpslvhaqnivatlavq
vilmglvegyrvnggpagegldplypgesfdplgladdpdtfaelkvkeikngrlamfsm
fgffvqaivtgkgpiqnlddhlsnptvnnafafatkftps

SCOPe Domain Coordinates for d7e0jy_:

Click to download the PDB-style file with coordinates for d7e0jy_.
(The format of our PDB-style files is described here.)

Timeline for d7e0jy_: