Lineage for d1csya_ (1csy A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82576Protein Syk tyrosine kinase [55575] (1 species)
  7. 82577Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries)
  8. 82590Domain d1csya_: 1csy A: [40519]

Details for d1csya_

PDB Entry: 1csy (more details)

PDB Description: syk tyrosine kinase c-terminal sh2 domain complexed with a phosphopeptidefrom the gamma chain of the high affinity immunoglobin g receptor, nmr

SCOP Domain Sequences for d1csya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csya_ d.93.1.1 (A:) Syk tyrosine kinase {Human (Homo sapiens)}
gsrrasvgshekmpwfhgkisreeseqivligsktngkflirardnngsyalcllhegkv
lhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltvpcqkigtq

SCOP Domain Coordinates for d1csya_:

Click to download the PDB-style file with coordinates for d1csya_.
(The format of our PDB-style files is described here.)

Timeline for d1csya_: