Lineage for d7e88e1 (7e88 E:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758767Domain d7e88e1: 7e88 E:1-106 [405165]
    Other proteins in same PDB: d7e88a_, d7e88b2, d7e88c_, d7e88d_, d7e88e2, d7e88f_, d7e88g_, d7e88h2, d7e88i_, d7e88j_, d7e88k2, d7e88l_
    automated match to d1dn0a1

Details for d7e88e1

PDB Entry: 7e88 (more details), 3.14 Å

PDB Description: crystal structure of the sars-cov-2 s rbd in complex with bd-515 fab
PDB Compounds: (E:) BD-515 Fab Light Chain

SCOPe Domain Sequences for d7e88e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e88e1 b.1.1.0 (E:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdinkylnwyqqkpgkapkllifdashletgvps
rfsasgsgtdftftisslqpediatyychqydnlprtfgqgtrlei

SCOPe Domain Coordinates for d7e88e1:

Click to download the PDB-style file with coordinates for d7e88e1.
(The format of our PDB-style files is described here.)

Timeline for d7e88e1: