Lineage for d7eg3d1 (7eg3 D:2-189)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324368Protein automated matches [190064] (22 species)
    not a true protein
  7. 2324439Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (7 PDB entries)
  8. 2324451Domain d7eg3d1: 7eg3 D:2-189 [405144]
    Other proteins in same PDB: d7eg3a2, d7eg3b2, d7eg3c2, d7eg3d2, d7eg3e2, d7eg3f2, d7eg3g2, d7eg3h2, d7eg3i2, d7eg3j2, d7eg3m2, d7eg3n2, d7eg3o2, d7eg3p2
    automated match to d4nqga_
    complexed with j2u

Details for d7eg3d1

PDB Entry: 7eg3 (more details), 2.09 Å

PDB Description: crystal structure of the apoaequorin complex with (s)-hm-dactz
PDB Compounds: (D:) Aequorin-2

SCOPe Domain Sequences for d7eg3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7eg3d1 a.39.1.5 (D:2-189) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkda
veaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqn
gaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpace
klyggavp

SCOPe Domain Coordinates for d7eg3d1:

Click to download the PDB-style file with coordinates for d7eg3d1.
(The format of our PDB-style files is described here.)

Timeline for d7eg3d1: