Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (22 species) not a true protein |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (7 PDB entries) |
Domain d7eg3d1: 7eg3 D:2-189 [405144] Other proteins in same PDB: d7eg3a2, d7eg3b2, d7eg3c2, d7eg3d2, d7eg3e2, d7eg3f2, d7eg3g2, d7eg3h2, d7eg3i2, d7eg3j2, d7eg3m2, d7eg3n2, d7eg3o2, d7eg3p2 automated match to d4nqga_ complexed with j2u |
PDB Entry: 7eg3 (more details), 2.09 Å
SCOPe Domain Sequences for d7eg3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7eg3d1 a.39.1.5 (D:2-189) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} kltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkda veaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqn gaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpace klyggavp
Timeline for d7eg3d1:
View in 3D Domains from other chains: (mouse over for more information) d7eg3a1, d7eg3a2, d7eg3b1, d7eg3b2, d7eg3c1, d7eg3c2, d7eg3e1, d7eg3e2, d7eg3f1, d7eg3f2, d7eg3g1, d7eg3g2, d7eg3h1, d7eg3h2, d7eg3i1, d7eg3i2, d7eg3j1, d7eg3j2, d7eg3k_, d7eg3l_, d7eg3m1, d7eg3m2, d7eg3n1, d7eg3n2, d7eg3o1, d7eg3o2, d7eg3p1, d7eg3p2 |