SCOPe 2.03: Domain d1a81g2: 1a81 G:152-262

Lineage for d1a81g2 (1a81 G:152-262)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Syk tyrosine kinase [55575] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries)

8. Domain d1a81g2: 1a81 G:152-262 [40514]

Details for d1a81g2

PDB Entry: 1a81, 3 Å

PDB Description: crystal structure of the tandem sh2 domain of the syk kinase bound to a dually tyrosine-phosphorylated itam

PDB Compounds: (G:) syk kinase

SCOPe Domain Sequences for d1a81g2:

Sequence; same for both SEQRES and ATOM records:

>d1a81g2 d.93.1.1 (G:152-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
pqlekliattahekmpwfhgkisreeseqivligsktngkflirardnngsyalcllheg
kvlhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltvpcqki

Timeline for d1a81g2:

• d1a81g2 first appeared (with stable ids) in SCOP 1.55
  
• d1a81g2 appears in SCOPe 2.02
  
• d1a81g2 appears in SCOPe 2.04
  
• d1a81g2 appears in the current release, SCOPe 2.08