Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (22 species) not a true protein |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (7 PDB entries) |
Domain d7eg2l_: 7eg2 L: [405130] Other proteins in same PDB: d7eg2a2, d7eg2b2, d7eg2c2, d7eg2d2, d7eg2e2, d7eg2f2, d7eg2g2, d7eg2h2, d7eg2i2, d7eg2j2, d7eg2m2, d7eg2n2, d7eg2o2, d7eg2p2 automated match to d4nqga_ complexed with j2x |
PDB Entry: 7eg2 (more details), 2.22 Å
SCOPe Domain Sequences for d7eg2l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7eg2l_ a.39.1.5 (L:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} kltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkda veaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqn gaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpace klyggavp
Timeline for d7eg2l_:
View in 3D Domains from other chains: (mouse over for more information) d7eg2a1, d7eg2a2, d7eg2b1, d7eg2b2, d7eg2c1, d7eg2c2, d7eg2d1, d7eg2d2, d7eg2e1, d7eg2e2, d7eg2f1, d7eg2f2, d7eg2g1, d7eg2g2, d7eg2h1, d7eg2h2, d7eg2i1, d7eg2i2, d7eg2j1, d7eg2j2, d7eg2k_, d7eg2m1, d7eg2m2, d7eg2n1, d7eg2n2, d7eg2o1, d7eg2o2, d7eg2p1, d7eg2p2 |