Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (14 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (26 PDB entries) |
Domain d7dxhd_: 7dxh d: [405120] Other proteins in same PDB: d7dxhb_, d7dxhc_, d7dxhe_, d7dxhf_, d7dxhh_, d7dxhi_, d7dxhk_, d7dxhl_, d7dxhm_, d7dxht_, d7dxhx_, d7dxhz_ automated match to d5zznd_ complexed with bcr, cl, cla, dgd, fe2, hem, htg, lmt, mge, pho, pq9, sqd, unl |
PDB Entry: 7dxh (more details), 3.14 Å
SCOPe Domain Sequences for d7dxhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dxhd_ f.26.1.1 (d:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe tfytknlllnegirawmapqdqphenfvfpeevlprgna
Timeline for d7dxhd_: