Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Syk tyrosine kinase [55575] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries) |
Domain d1a81e2: 1a81 E:152-262 [40512] |
PDB Entry: 1a81 (more details), 3 Å
SCOPe Domain Sequences for d1a81e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a81e2 d.93.1.1 (E:152-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} pqlekliattahekmpwfhgkisreeseqivligsktngkflirardnngsyalcllheg kvlhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltvpcqki
Timeline for d1a81e2: