SCOP 1.55: Domain d1a81c2: 1a81 C:138-262

Lineage for d1a81c2 (1a81 C:138-262)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (19 proteins)

6. Protein Syk tyrosine kinase [55575] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries)

8. Domain d1a81c2: 1a81 C:138-262 [40510]

Details for d1a81c2

PDB Entry: 1a81, 3 Å

PDB Description: crystal structure of the tandem sh2 domain of the syk kinase bound to a dually tyrosine-phosphorylated itam

SCOP Domain Sequences for d1a81c2:

Sequence; same for both SEQRES and ATOM records:

>d1a81c2 d.93.1.1 (C:138-262) Syk tyrosine kinase {Human (Homo sapiens)}
lqgqaleqaiisqkpqlekliattahekmpwfhgkisreeseqivligsktngkflirar
dnngsyalcllhegkvlhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltv
pcqki

Timeline for d1a81c2:

• d1a81c2 appears in SCOP 1.57
  
• d1a81c2 appears in the current release, SCOPe 2.08