Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) automatically mapped to Pfam PF02533 |
Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
Protein automated matches [339417] (5 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [405092] (1 PDB entry) |
Domain d7dxhk_: 7dxh k: [405093] Other proteins in same PDB: d7dxha_, d7dxhb_, d7dxhc_, d7dxhd_, d7dxhe_, d7dxhf_, d7dxhh_, d7dxhi_, d7dxhl_, d7dxhm_, d7dxht_, d7dxhx_, d7dxhz_ automated match to d5h2fk_ complexed with bcr, cl, cla, dgd, fe2, hem, htg, lmt, mge, pho, pq9, sqd, unl |
PDB Entry: 7dxh (more details), 3.14 Å
SCOPe Domain Sequences for d7dxhk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dxhk_ f.23.36.1 (k:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} peayaifdplvdvlpvipvlflalafvwqaavgf
Timeline for d7dxhk_: