SCOPe 2.07: Domain d1ab2a_: 1ab2 A:

Lineage for d1ab2a_ (1ab2 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Proto-oncogen tyrosine kinase [55573] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55574] (2 PDB entries)

8. Domain d1ab2a_: 1ab2 A: [40506]

Details for d1ab2a_

PDB Entry: 1ab2

PDB Description: three-dimensional solution structure of the src homology 2 domain of c-abl

PDB Compounds: (A:) c-abl tyrosine kinase sh2 domain

SCOPe Domain Sequences for d1ab2a_:

Sequence; same for both SEQRES and ATOM records:

>d1ab2a_ d.93.1.1 (A:) Proto-oncogen tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
gsgnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyri
ntasdgklyvssesrfntlaelvhhhstvadglittlhypapkrgihrd

Timeline for d1ab2a_:

• d1ab2a_ first appeared (with stable ids) in SCOP 1.55, called d1ab2__
  
• d1ab2a_ appears in SCOPe 2.06
  
• d1ab2a_ appears in the current release, SCOPe 2.08, called d1ab2a1