SCOPe 2.07: Domain d7dc6a2: 7dc6 A:183-276

Lineage for d7dc6a2 (7dc6 A:183-276)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Ailuropoda melanoleuca [TaxId:9646] [404985] (1 PDB entry)
Domain d7dc6a2: 7dc6 A:183-276 [405055]
Other proteins in same PDB: d7dc6a1, d7dc6b2, d7dc6c1, d7dc6d2, d7dc6d3
automated match to d1a1ma1

Details for d7dc6a2

PDB Entry: 7dc6 (more details), 2.68 Å

PDB Description: giant panda mhc class i complexes

PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d7dc6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dc6a2 b.1.1.2 (A:183-276) automated matches {Ailuropoda melanoleuca [TaxId: 9646]}
aetpdtrvtrhpisdqkvtlrcwalgfypaeitltwqqdgedltqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpepltrswe

SCOPe Domain Coordinates for d7dc6a2:

Click to download the PDB-style file with coordinates for d7dc6a2.
(The format of our PDB-style files is described here.)

Timeline for d7dc6a2: