Lineage for d1fu5a_ (1fu5 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82546Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)
  7. 82556Species Rat (Rattus norvegicus) [TaxId:10116] [55572] (2 PDB entries)
  8. 82558Domain d1fu5a_: 1fu5 A: [40505]

Details for d1fu5a_

PDB Entry: 1fu5 (more details)

PDB Description: nmr structure of the n-sh2 domain of the p85 subunit of pi3-kinase complexed to a doubly phosphorylated peptide derived from polyomavirus middle t antigen

SCOP Domain Sequences for d1fu5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fu5a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus)}
gmnnnmslqdaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnks
ikifhrdgkygfsdpltfnsvvelinhyrneslaqynpkldvkllypvsky

SCOP Domain Coordinates for d1fu5a_:

Click to download the PDB-style file with coordinates for d1fu5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fu5a_: