Lineage for d7dc6d1 (7dc6 D:6-95)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361217Species Ailuropoda melanoleuca [TaxId:9646] [404985] (1 PDB entry)
  8. 2361221Domain d7dc6d1: 7dc6 D:6-95 [405049]
    Other proteins in same PDB: d7dc6a1, d7dc6b2, d7dc6c1, d7dc6d2, d7dc6d3
    automated match to d5xmfb_

Details for d7dc6d1

PDB Entry: 7dc6 (more details), 2.68 Å

PDB Description: giant panda mhc class i complexes
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d7dc6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dc6d1 b.1.1.2 (D:6-95) automated matches {Ailuropoda melanoleuca [TaxId: 9646]}
pkiqvysrhpaengkpnflncyvsgfhppeieidllkngekmkaeqsdlsfskdwtfyll
vhteftpngqdefscrvkhvtlsepqiikw

SCOPe Domain Coordinates for d7dc6d1:

Click to download the PDB-style file with coordinates for d7dc6d1.
(The format of our PDB-style files is described here.)

Timeline for d7dc6d1: