Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Ailuropoda melanoleuca [TaxId:9646] [404985] (1 PDB entry) |
Domain d7dc6d1: 7dc6 D:6-95 [405049] Other proteins in same PDB: d7dc6a1, d7dc6b2, d7dc6c1, d7dc6d2, d7dc6d3 automated match to d5xmfb_ |
PDB Entry: 7dc6 (more details), 2.68 Å
SCOPe Domain Sequences for d7dc6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dc6d1 b.1.1.2 (D:6-95) automated matches {Ailuropoda melanoleuca [TaxId: 9646]} pkiqvysrhpaengkpnflncyvsgfhppeieidllkngekmkaeqsdlsfskdwtfyll vhteftpngqdefscrvkhvtlsepqiikw
Timeline for d7dc6d1: