Lineage for d1pica_ (1pic A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1919025Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)
  7. 1919034Species Human (Homo sapiens) [TaxId:9606] [55571] (2 PDB entries)
  8. 1919036Domain d1pica_: 1pic A: [40503]

Details for d1pica_

PDB Entry: 1pic (more details)

PDB Description: phosphatidylinositol 3-kinase, p85-alpha subunit: c-terminal sh2 domain complexed with a tyr751 phosphopeptide from the pdgf receptor, nmr, minimized mean structure
PDB Compounds: (A:) phosphatidylinositol 3-kinase

SCOPe Domain Sequences for d1pica_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pica_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr

SCOPe Domain Coordinates for d1pica_:

Click to download the PDB-style file with coordinates for d1pica_.
(The format of our PDB-style files is described here.)

Timeline for d1pica_: