Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [55571] (2 PDB entries) |
Domain d1pica_: 1pic A: [40503] |
PDB Entry: 1pic (more details)
SCOPe Domain Sequences for d1pica_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pica_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Human (Homo sapiens) [TaxId: 9606]} gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr
Timeline for d1pica_: