SCOP 1.57: Domain d1pica_: 1pic A:

Lineage for d1pica_ (1pic A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (20 proteins)

6. Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55571] (2 PDB entries)

8. Domain d1pica_: 1pic A: [40503]

Details for d1pica_

PDB Entry: 1pic

PDB Description: phosphatidylinositol 3-kinase, p85-alpha subunit: c-terminal sh2 domain complexed with a tyr751 phosphopeptide from the pdgf receptor, nmr, minimized mean structure

SCOP Domain Sequences for d1pica_:

Sequence; same for both SEQRES and ATOM records:

>d1pica_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Human (Homo sapiens)}
gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr

Timeline for d1pica_:

• d1pica_ first appeared (with stable ids) in SCOP 1.55
  
• d1pica_ appears in SCOP 1.59
  
• d1pica_ appears in the current release, SCOPe 2.08, called d1pica1