Lineage for d7ddqb_ (7ddq B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627145Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 2627146Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 2627147Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins)
  6. 2627200Protein automated matches [404989] (1 species)
    not a true protein
  7. 2627201Species Rhodobacter veldkampii [TaxId:1185920] [404990] (1 PDB entry)
  8. 2627202Domain d7ddqb_: 7ddq B: [405024]
    Other proteins in same PDB: d7ddqa_, d7ddqd_, d7ddqg_, d7ddqh1, d7ddqh2, d7ddql_, d7ddqm_, d7ddqn_, d7ddqo_, d7ddqs_, d7ddqt_, d7ddqu_
    automated match to d1jo5a_
    complexed with bcl, bph, fe, peh, spo, u10

Details for d7ddqb_

PDB Entry: 7ddq (more details), 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii
PDB Compounds: (B:) Antenna pigment protein beta chain

SCOPe Domain Sequences for d7ddqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ddqb_ f.3.1.1 (B:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
dlsftgltdqqaqelhsvylqgmwlfisvaivahlavfiwrpwl

SCOPe Domain Coordinates for d7ddqb_:

Click to download the PDB-style file with coordinates for d7ddqb_.
(The format of our PDB-style files is described here.)

Timeline for d7ddqb_: