Lineage for d2pnb__ (2pnb -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (20 proteins) 
Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species) 
Species Cow (Bos taurus) [TaxId:9913] [55570] (5 PDB entries) 
Domain d2pnb__: 2pnb - [40502]
Details for d2pnb__
PDB Entry: 2pnb (more details)
PDB Description: structure of an sh2 domain of the p85 alpha subunit of phosphatidylinositol-3-oh kinase
SCOP Domain Sequences for d2pnb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pnb__ d.93.1.1 (-) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus)}
lqdaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnklikifhrd
gkygfsdpltfnsvvelinhyrneslaqynpkldvkllypvsky
SCOP Domain Coordinates for d2pnb__:
Click to download the PDB-style file with coordinates for d2pnb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pnb__:
- d2pnb__ first appeared (with stable ids) in SCOP 1.55
- d2pnb__ appears in SCOP 1.59
- d2pnb__ appears in the current release, SCOPe 2.08, called d2pnba_
View in 3D