Lineage for d7ddqu_ (7ddq u:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627145Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 2627146Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 2627209Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 2627210Protein automated matches [254444] (7 species)
    not a true protein
  7. 2627236Species Rhodobacter veldkampii [TaxId:1185920] [404997] (1 PDB entry)
  8. 2627244Domain d7ddqu_: 7ddq u: [405014]
    Other proteins in same PDB: d7ddqb_, d7ddqe_, d7ddqf_, d7ddqh1, d7ddqh2, d7ddqi_, d7ddqj_, d7ddqk_, d7ddql_, d7ddqm_, d7ddqr_
    automated match to d1xrda1
    complexed with bcl, bph, fe, peh, spo, u10

Details for d7ddqu_

PDB Entry: 7ddq (more details), 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii
PDB Compounds: (u:) Antenna pigment protein alpha chain

SCOPe Domain Sequences for d7ddqu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ddqu_ f.3.1.0 (u:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
kfykiwlifdprrvfvaqgvflfllavmihlmllsnpgfnwldisgvkyerv

SCOPe Domain Coordinates for d7ddqu_:

Click to download the PDB-style file with coordinates for d7ddqu_.
(The format of our PDB-style files is described here.)

Timeline for d7ddqu_: