Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (14 species) not a true protein |
Species Rhodobacter veldkampii [TaxId:1185920] [405012] (1 PDB entry) |
Domain d7ddql_: 7ddq L: [405013] Other proteins in same PDB: d7ddqa_, d7ddqb_, d7ddqd_, d7ddqe_, d7ddqf_, d7ddqg_, d7ddqh1, d7ddqh2, d7ddqi_, d7ddqj_, d7ddqk_, d7ddqn_, d7ddqo_, d7ddqr_, d7ddqs_, d7ddqt_, d7ddqu_ automated match to d2wx5l_ complexed with bcl, bph, fe, peh, spo, u10 |
PDB Entry: 7ddq (more details), 2.84 Å
SCOPe Domain Sequences for d7ddql_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ddql_ f.26.1.1 (L:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]} allsferkyrvpggtliggnlfdfwvgpfyvgffgvtsvffaalgtlmilwgaslgdtwn pllisinpppleyglgaaplreggiwqvvtlcaigafvswamreveicrklgiglhipfa fsfaifayitlvvirpalmgawghgfqygvfthlewvnnvgyqygnfhynplhmlgislf ftttlalglhgalilsaanpetgkemrtpdhedtffrdlvgysvgtlgihrlglllalna afwsamcilasgtvwfdqwvfwwdwwynlpfwadl
Timeline for d7ddql_: