Lineage for d7ddql_ (7ddq L:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632815Protein automated matches [190224] (14 species)
    not a true protein
  7. 2632902Species Rhodobacter veldkampii [TaxId:1185920] [405012] (1 PDB entry)
  8. 2632903Domain d7ddql_: 7ddq L: [405013]
    Other proteins in same PDB: d7ddqa_, d7ddqb_, d7ddqd_, d7ddqe_, d7ddqf_, d7ddqg_, d7ddqh1, d7ddqh2, d7ddqi_, d7ddqj_, d7ddqk_, d7ddqn_, d7ddqo_, d7ddqr_, d7ddqs_, d7ddqt_, d7ddqu_
    automated match to d2wx5l_
    complexed with bcl, bph, fe, peh, spo, u10

Details for d7ddql_

PDB Entry: 7ddq (more details), 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii
PDB Compounds: (L:) Photosynthetic reaction center L subunit

SCOPe Domain Sequences for d7ddql_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ddql_ f.26.1.1 (L:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
allsferkyrvpggtliggnlfdfwvgpfyvgffgvtsvffaalgtlmilwgaslgdtwn
pllisinpppleyglgaaplreggiwqvvtlcaigafvswamreveicrklgiglhipfa
fsfaifayitlvvirpalmgawghgfqygvfthlewvnnvgyqygnfhynplhmlgislf
ftttlalglhgalilsaanpetgkemrtpdhedtffrdlvgysvgtlgihrlglllalna
afwsamcilasgtvwfdqwvfwwdwwynlpfwadl

SCOPe Domain Coordinates for d7ddql_:

Click to download the PDB-style file with coordinates for d7ddql_.
(The format of our PDB-style files is described here.)

Timeline for d7ddql_: