SCOPe 2.04: Domain d1bfia_: 1bfi A:

Lineage for d1bfia_ (1bfi A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55570] (7 PDB entries)

8. Domain d1bfia_: 1bfi A: [40499]
   C-terminal SH2 domain

Details for d1bfia_

PDB Entry: 1bfi

PDB Description: solution structure of the c-terminal sh2 domain of the p85alpha regulatory subunit of phosphoinositide 3-kinase, nmr, 30 structures

PDB Compounds: (A:) p85 alpha

SCOPe Domain Sequences for d1bfia_:

Sequence; same for both SEQRES and ATOM records:

>d1bfia_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]}
edlphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvin
ktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr

Timeline for d1bfia_:

• d1bfia_ first appeared (with stable ids) in SCOP 1.55, called d1bfi__
  
• d1bfia_ appears in SCOPe 2.03
  
• d1bfia_ appears in SCOPe 2.05
  
• d1bfia_ appears in the current release, SCOPe 2.08