Lineage for d1qada_ (1qad A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135973Fold d.93: SH2-like [55549] (1 superfamily)
  4. 135974Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 135975Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 136071Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)
  7. 136072Species Cow (Bos taurus) [TaxId:9913] [55570] (5 PDB entries)
  8. 136073Domain d1qada_: 1qad A: [40498]

Details for d1qada_

PDB Entry: 1qad (more details), 1.8 Å

PDB Description: Crystal Structure of the C-Terminal SH2 Domain of the P85 alpha Regulatory Subunit of Phosphoinositide 3-Kinase: An SH2 domain mimicking its own substrate

SCOP Domain Sequences for d1qada_:

Sequence, based on SEQRES records: (download)

>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus)}
edlphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvin
ktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvya

Sequence, based on observed residues (ATOM records): (download)

>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus)}
edlphhdektwnvgssnrnkaenllrgkrdgtflvresgcyacsvvvdgevkhcvinkta
tgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvya

SCOP Domain Coordinates for d1qada_:

Click to download the PDB-style file with coordinates for d1qada_.
(The format of our PDB-style files is described here.)

Timeline for d1qada_: