SCOP 1.75: Domain d1tcea_: 1tce A:

Lineage for d1tcea_ (1tce A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (34 proteins)
   Pfam PF00017

6. Protein Shc adaptor protein [55567] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55568] (2 PDB entries)

8. Domain d1tcea_: 1tce A: [40497]

Details for d1tcea_

PDB Entry: 1tce

PDB Description: solution nmr structure of the shc sh2 domain complexed with a tyrosine-phosphorylated peptide from the t-cell receptor, minimized average structure

PDB Compounds: (A:) shc

SCOP Domain Sequences for d1tcea_:

Sequence; same for both SEQRES and ATOM records:

>d1tcea_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]}
aeqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltgsqsgqpkhlllvdpe
gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverklleh

Timeline for d1tcea_:

• d1tcea_ first appeared (with stable ids) in SCOP 1.55
  
• d1tcea_ appears in SCOP 1.73
  
• d1tcea_ appears in SCOPe 2.01
  
• d1tcea_ appears in the current release, SCOPe 2.08, called d1tcea1