Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (28 proteins) |
Protein Hemopoetic cell kinase Hck [55565] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries) |
Domain d3hck__: 3hck - [40495] |
PDB Entry: 3hck (more details)
SCOP Domain Sequences for d3hck__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hck__ d.93.1.1 (-) Hemopoetic cell kinase Hck {Human (Homo sapiens)} meteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhy kirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmssk
Timeline for d3hck__: