SCOP 1.65: Domain d3hck__: 3hck -

Lineage for d3hck__ (3hck -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (25 proteins)

6. Protein Hemopoetic cell kinase Hck [55565] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries)

8. Domain d3hck__: 3hck - [40495]

Details for d3hck__

PDB Entry: 3hck

PDB Description: nmr ensemble of the uncomplexed human hck sh2 domain, 20 structures

SCOP Domain Sequences for d3hck__:

Sequence; same for both SEQRES and ATOM records:

>d3hck__ d.93.1.1 (-) Hemopoetic cell kinase Hck {Human (Homo sapiens)}
meteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhy
kirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmssk

Timeline for d3hck__:

• d3hck__ first appeared (with stable ids) in SCOP 1.55
  
• d3hck__ appears in SCOP 1.63
  
• d3hck__ appears in SCOP 1.67
  
• d3hck__ appears in the current release, SCOPe 2.08, called d3hcka1