Lineage for d3hck__ (3hck -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82520Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 82521Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries)
  8. 82527Domain d3hck__: 3hck - [40495]

Details for d3hck__

PDB Entry: 3hck (more details)

PDB Description: nmr ensemble of the uncomplexed human hck sh2 domain, 20 structures

SCOP Domain Sequences for d3hck__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hck__ d.93.1.1 (-) Hemopoetic cell kinase Hck {Human (Homo sapiens)}
meteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhy
kirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmssk

SCOP Domain Coordinates for d3hck__:

Click to download the PDB-style file with coordinates for d3hck__.
(The format of our PDB-style files is described here.)

Timeline for d3hck__: