Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255800] (14 PDB entries) |
Domain d7csfc_: 7csf C: [404949] automated match to d1qyda_ complexed with go6, ndp |
PDB Entry: 7csf (more details), 1.98 Å
SCOPe Domain Sequences for d7csfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7csfc_ c.2.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ktrvlvvgatgyigkrivraclaeghetyvlqrpeigleiekvqlflsfkklgarivegs fsdhqslvsavklvdvvvsamsgvhfrshnilvqlklveaikeagnvkrflpsefgmdpp rmghalppgretfdqkmevrqaieaagipytyvvgacfaayfagnlsqmvtllppkekvn iygdgnvkvvfadeddiakytaktlndprtlnktvnirppdnvltqlelvqiwekltgke lektniaaqdflanieqmeiphqagighfyhifyegcltdhevgedeeasslypdvkykr mddylrmfl
Timeline for d7csfc_: