Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Hemopoetic cell kinase Hck [55565] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries) |
Domain d2hckb2: 2hck B:146-248 [40494] Other proteins in same PDB: d2hcka1, d2hcka3, d2hckb1, d2hckb3 complexed with ca, que |
PDB Entry: 2hck (more details), 3 Å
SCOPe Domain Sequences for d2hckb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hckb2 d.93.1.1 (B:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d2hckb2: