Lineage for d2hckb2 (2hck B:146-248)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332255Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 332256Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 332257Family d.93.1.1: SH2 domain [55551] (25 proteins)
  6. 332370Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 332371Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries)
  8. 332376Domain d2hckb2: 2hck B:146-248 [40494]
    Other proteins in same PDB: d2hcka1, d2hcka3, d2hckb1, d2hckb3
    complexed with ca, que

Details for d2hckb2

PDB Entry: 2hck (more details), 3 Å

PDB Description: src family kinase hck-quercetin complex

SCOP Domain Sequences for d2hckb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hckb2 d.93.1.1 (B:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens)}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOP Domain Coordinates for d2hckb2:

Click to download the PDB-style file with coordinates for d2hckb2.
(The format of our PDB-style files is described here.)

Timeline for d2hckb2: