Lineage for d1ad5b2 (1ad5 B:146-248)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1661865Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1662095Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 1662096Species Human (Homo sapiens) [TaxId:9606] [55566] (18 PDB entries)
  8. 1662120Domain d1ad5b2: 1ad5 B:146-248 [40492]
    Other proteins in same PDB: d1ad5a1, d1ad5a3, d1ad5b1, d1ad5b3
    complexed with anp, ca

Details for d1ad5b2

PDB Entry: 1ad5 (more details), 2.6 Å

PDB Description: src family kinase hck-amp-pnp complex
PDB Compounds: (B:) haematopoetic cell kinase hck

SCOPe Domain Sequences for d1ad5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad5b2 d.93.1.1 (B:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d1ad5b2:

Click to download the PDB-style file with coordinates for d1ad5b2.
(The format of our PDB-style files is described here.)

Timeline for d1ad5b2: