SCOP 1.67: Domain d1ad5b2: 1ad5 B:146-248

Lineage for d1ad5b2 (1ad5 B:146-248)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (28 proteins)

6. Protein Hemopoetic cell kinase Hck [55565] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries)

8. Domain d1ad5b2: 1ad5 B:146-248 [40492]
   Other proteins in same PDB: d1ad5a1, d1ad5a3, d1ad5b1, d1ad5b3
   complexed with anp, ca

Details for d1ad5b2

PDB Entry: 1ad5, 2.6 Å

PDB Description: src family kinase hck-amp-pnp complex

SCOP Domain Sequences for d1ad5b2:

Sequence; same for both SEQRES and ATOM records:

>d1ad5b2 d.93.1.1 (B:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens)}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

Timeline for d1ad5b2:

• d1ad5b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ad5b2 appears in SCOP 1.65
  
• d1ad5b2 appears in SCOP 1.69
  
• d1ad5b2 appears in the current release, SCOPe 2.08