SCOPe 2.07: Domain d7cslb2: 7csl B:216-316

Lineage for d7cslb2 (7csl B:216-316)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (29 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [268109] (2 PDB entries)

8. Domain d7cslb2: 7csl B:216-316 [404906]
   Other proteins in same PDB: d7csla1, d7csla3, d7cslb1, d7cslb3
   automated match to d3wyaa2

Details for d7cslb2

PDB Entry: 7csl, 2 Å

PDB Description: crystal structure of the archaeal ef1a-ef1b complex

PDB Compounds: (B:) Elongation factor 1-alpha

SCOPe Domain Sequences for d7cslb2:

Sequence; same for both SEQRES and ATOM records:

>d7cslb2 b.43.3.0 (B:216-316) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
pidkplripiqdvysikgvgtvpvgrvetgklkvgdvvifepastifhkpiqgevksiem
hheplqealpgdnigfnvrgvskndikrgdvaghtdkpptv

Timeline for d7cslb2:

• d7cslb2 is new in SCOPe 2.07-stable
  
• d7cslb2 appears in the current release, SCOPe 2.08