SCOP 1.63: Domain d1qcfa2: 1qcf A:146-248

Lineage for d1qcfa2 (1qcf A:146-248)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (22 proteins)

6. Protein Hemopoetic cell kinase Hck [55565] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries)

8. Domain d1qcfa2: 1qcf A:146-248 [40490]
   Other proteins in same PDB: d1qcfa1, d1qcfa3
   complexed with pp1; mutant

Details for d1qcfa2

PDB Entry: 1qcf, 2 Å

PDB Description: crystal structure of hck in complex with a src family-selective tyrosine kinase inhibitor

SCOP Domain Sequences for d1qcfa2:

Sequence; same for both SEQRES and ATOM records:

>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens)}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

Timeline for d1qcfa2:

• d1qcfa2 first appeared (with stable ids) in SCOP 1.55
  
• d1qcfa2 appears in SCOP 1.61
  
• d1qcfa2 appears in SCOP 1.65
  
• d1qcfa2 appears in the current release, SCOPe 2.08