Lineage for d1qcfa2 (1qcf A:146-248)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965473Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 2965474Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)
  8. 2965484Domain d1qcfa2: 1qcf A:146-248 [40490]
    Other proteins in same PDB: d1qcfa1, d1qcfa3
    complexed with pp1

Details for d1qcfa2

PDB Entry: 1qcf (more details), 2 Å

PDB Description: crystal structure of hck in complex with a src family-selective tyrosine kinase inhibitor
PDB Compounds: (A:) haematopoetic cell kinase (hck)

SCOPe Domain Sequences for d1qcfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d1qcfa2:

Click to download the PDB-style file with coordinates for d1qcfa2.
(The format of our PDB-style files is described here.)

Timeline for d1qcfa2: