Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Penaeus japonicus [TaxId:27405] [379454] (14 PDB entries) |
Domain d7cpcf1: 7cpc F:2-155 [404872] Other proteins in same PDB: d7cpca2, d7cpcb2, d7cpcc2, d7cpcd2, d7cpce2, d7cpcf2 automated match to d5wpna_ complexed with fe, ni |
PDB Entry: 7cpc (more details), 2.8 Å
SCOPe Domain Sequences for d7cpcf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cpcf1 a.25.1.0 (F:2-155) automated matches {Penaeus japonicus [TaxId: 27405]} asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn ndphltklledeyleeqvdsikkigdmitklkr
Timeline for d7cpcf1: