Lineage for d7cyba_ (7cyb A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390973Species Saimiri boliviensis [TaxId:39432] [404844] (2 PDB entries)
  8. 2390974Domain d7cyba_: 7cyb A: [404845]
    automated match to d4xzpa_
    complexed with gol

Details for d7cyba_

PDB Entry: 7cyb (more details), 1.6 Å

PDB Description: saimiri boliviensis boliviensis galectin-13 with glycerol
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d7cyba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cyba_ b.29.1.0 (A:) automated matches {Saimiri boliviensis [TaxId: 39432]}
msslpvpyklpvslstgacviikgrpklsfindpqlqvdfytgtdedsdiafhfrvhfgh
rvvmnslefgvwkleekihyvpfedgepfelriyvrhseyevkvngqyiygfahrhppsy
vkmiqvwrdvsltsvcvyn

SCOPe Domain Coordinates for d7cyba_:

Click to download the PDB-style file with coordinates for d7cyba_.
(The format of our PDB-style files is described here.)

Timeline for d7cyba_: