Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Saimiri boliviensis [TaxId:39432] [404844] (2 PDB entries) |
Domain d7cyba_: 7cyb A: [404845] automated match to d4xzpa_ complexed with gol |
PDB Entry: 7cyb (more details), 1.6 Å
SCOPe Domain Sequences for d7cyba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cyba_ b.29.1.0 (A:) automated matches {Saimiri boliviensis [TaxId: 39432]} msslpvpyklpvslstgacviikgrpklsfindpqlqvdfytgtdedsdiafhfrvhfgh rvvmnslefgvwkleekihyvpfedgepfelriyvrhseyevkvngqyiygfahrhppsy vkmiqvwrdvsltsvcvyn
Timeline for d7cyba_: